Home Products

research chemicals crystal

Certification
Good quality Peptide APIs for sales
Good quality Peptide APIs for sales
Customer Reviews
Good Price .Product is by far the besT, very pleased and happy, wil buy again.

—— K******s United Kingdom

High Purity, fast shipping ,recomended this company.

—— Perry*****t United State

Great service I was kept informed about my order the whole time Thanks Jones.

—— E****y Australia

I'm Online Chat Now

research chemicals crystal

(26)
China Research Peptide Angiotensin acetate CAS 58-49-1 Angiotensin Quality Guarantee Free Shipping factory

Research Peptide Angiotensin acetate CAS 58-49-1 Angiotensin Quality Guarantee Free Shipping

Base information of Angiotensin Acetate Chemical Name: Angiotensin Acetate Sequence: Mpa-D-Tyr(ET)-Ile-Thr-Asn-Cys-Pro-Orn-Gly-NH2 CAS NO. 90779-69-4 Molecular Formula :C43H67N11O12S2 Molecular Weight: 994.19 ... Read More
2019-01-22 13:54:04
China Research Peptide Hormone Cetrorelix Acetate CAS 130143 01 0  Purity 98% factory

Research Peptide Hormone Cetrorelix Acetate CAS 130143 01 0 Purity 98%

Chemical Name: Cetrorelix acetate CAS NO.: 130143-01-0 Synonyms: Cetrorelix acetate Purity:99% Cetrorelix acetate Appearance: white powder Shelf life:2 years for Cetrorelix acetate Storage:Cetrorelix acetate ... Read More
2019-01-22 13:54:09
China FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity factory

FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity

Product Name :FOXO4 D-Retro-Inverso(DRI) peptide Sequence H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH Three letter code H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D... Read More
2019-01-22 13:54:15
China CAS 1356922-05-8  ACE 031 ,ACE031, ACE-031 ACVR2B 99% Purity factory

CAS 1356922-05-8 ACE 031 ,ACE031, ACE-031 ACVR2B 99% Purity

Base infor. Chemical Name: ACE 031 Molecular Formula: C33H57N11O9 Molecular Weight: 1311.45 Purity: 99% Specification: 2mg or according to requirements Delivery: Within 3-5 days Shipping: By Express with ... Read More
2019-01-22 13:54:05
China MT2 MT -2 Melanotan II Melanotan 2 Peptide Powder 99% Purity USP Standard factory

MT2 MT -2 Melanotan II Melanotan 2 Peptide Powder 99% Purity USP Standard

GMP Manufacturer Supply Peptide hormone injection MT2/MT-2 /Melanotan II, Melanotan2 BP/USP Factory Price Safe Shipping Introduction Product Name: Melanotan II Acetate peptides injection MT-2 powder in bulk ... Read More
2019-02-19 10:28:59
China Blue Tops HGH 191AA  Injection Human Growth Hormone 10iu Vials For Bodybuilding Supplements factory

Blue Tops HGH 191AA Injection Human Growth Hormone 10iu Vials For Bodybuilding Supplements

Description: EINECS No.: 235-735-8 CAS : 12629-01-5 Feature: high bioactivity, high stability, high purity, 191 aa hgh Molecular formula: C990H1528N262O300S7 Formula weight: 22125D Category: White Lyophilized ... Read More
2019-01-22 13:54:14
China Somatropin GH 191AA 10iu Vials Blue Tops BP USP Standard Free Sample factory

Somatropin GH 191AA 10iu Vials Blue Tops BP USP Standard Free Sample

Name: r-hg Appearance: White Freeze dried Powder Specification: 10 iu/vial 10vial/kit 100iu/kit Stock: In stock Supply Ability: Bulk Delivery:FedeEx, EMS, HKEMS, TNT, DHL, UPS Delivery time:within 24 hours ... Read More
2019-03-01 14:21:05
China CAS 1262780 97 1 AMG 416 Etelcalcetide Peptide 99% Purity Pharmaceutical Intermediates factory

CAS 1262780 97 1 AMG 416 Etelcalcetide Peptide 99% Purity Pharmaceutical Intermediates

Supply High Purity General peptide AMG-416 Etelcalcetide Cas 1262780-97-1 Quality Guarantee Free Samples Name: Etelcalcetide CAS No. : 1262780-97-1 Molecular formula: C38H74ClN21O10S2 Molecular weight : 1084.71 ... Read More
2019-01-22 13:54:02
China Follistatin 344 Peptide  Hormone  Power 99% Purity Pharmaceutical Grade factory

Follistatin 344 Peptide Hormone Power 99% Purity Pharmaceutical Grade

Basic Info: follistatin 344, Peptide Follistatin 344 Specification:(1mg/vial,10vial/box) Standard: USP Grade, GMP Grade Standard: Medicine Grade Appearance:Sterile Filtered White Lyophilized (Freeze-Dried) ... Read More
2019-01-22 13:54:10
China Melanotan II Acetate MT -2 CAS 121062-08-6 10mg Vials For Skin Tanning factory

Melanotan II Acetate MT -2 CAS 121062-08-6 10mg Vials For Skin Tanning

Product Name: Melanotan2 Other Name: Melanotan 2, MT-II Synonyms: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2 CAS #: 121062-08-6 Purity: 99% min. Molecular Formula: C50H69N15O9 Molecular Weight: 1024.18 We are ... Read More
2019-02-19 10:30:06
Page 1 of 3|< 1 2 3 >|