Home ProductsPeptide Hormone Research

FOXO4 DRI Peptide 98% Purity For For Anti aging and Longevity Research

Certification
Good quality Peptide APIs for sales
Good quality Peptide APIs for sales
Customer Reviews
Good Price .Product is by far the besT, very pleased and happy, wil buy again.

—— K******s United Kingdom

High Purity, fast shipping ,recomended this company.

—— Perry*****t United State

Great service I was kept informed about my order the whole time Thanks Jones.

—— E****y Australia

I'm Online Chat Now

FOXO4 DRI Peptide 98% Purity For For Anti aging and Longevity Research

China FOXO4 DRI Peptide  98% Purity For  For Anti aging and Longevity Research supplier
FOXO4 DRI Peptide  98% Purity For  For Anti aging and Longevity Research supplier

Large Image :  FOXO4 DRI Peptide 98% Purity For For Anti aging and Longevity Research

Product Details:

Place of Origin: CHINA
Brand Name: MOBELBIO

Payment & Shipping Terms:

Minimum Order Quantity: 10mg
Price: 1
Packaging Details: 10mg/Bottle
Delivery Time: Within 1-3 Days
Payment Terms: T/T, Western Union, MoneyGram
Supply Ability: 10G/Month
Contact Now
Detailed Product Description
Name: FOXO4 Peptide Purity: 98%min
For: Anti Aging Chemical Name: FOXO4-DR

Custom peptide synthesis FOXO4 peptide ,FOXO4-DR with 98%min purity For Anti aging and Longevity Research

 

Descriptions

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRIpeptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging

Remarks: The product is restricted for lab research.

Contact Details
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

Contact Person: admin

Send your inquiry directly to us (0 / 3000)