A premium membership for higher-level suppliers.

The products we provided are for lab research or production only,forbidden for private consumptions directly.

 

 

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home ProductsPeptide Hormone Research

FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity

Certification
Good quality Peptide APIs for sales
Good quality Peptide APIs for sales
Good Price .Product is by far the besT, very pleased and happy, wil buy again.

—— K******s United Kingdom

High Purity, fast shipping ,recomended this company.

—— Perry*****t United State

Great service I was kept informed about my order the whole time Thanks Jones.

—— E****y Australia

I'm Online Chat Now

FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity

China FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity supplier
FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity supplier FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity supplier FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity supplier

Large Image :  FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity

Product Details:

Place of Origin: CHINA
Brand Name: MOBELBIO
Certification: ISO,SGS

Payment & Shipping Terms:

Minimum Order Quantity: 10mg
Price: According to order amounts
Packaging Details: Vials or bottle
Delivery Time: Within 3-5 days
Payment Terms: T/T
Supply Ability: 1gram/ Day
Contact Now
Detailed Product Description
Purity: 97% Min Appearance: White Powder

 

  • Product Name :FOXO4 D-Retro-Inverso(DRI) peptide
  • Sequence
    H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
  • Three letter code
    H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Length (aa): 46
  • Peptide Purity (HPLC)  :97%  Min
  • Molecular Formula :C228H388N86O64
  • Molecular Weight :5358.05
  • Source : Synthetic
  • Quality:See COA,MS,HPLC,MSDS reports
  • Descriptions of FOXO4 DRI
  • FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity
    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
  • Storage Guidelines
    Ideally FOXO4 D-Retro-Inverso(DRI) peptide should be stored in a freezer at or below -9C. FOXO4 D-Retro-Inverso(DRI) peptide should be refrigerated after reconstitution. 
  •  
  • Remarks: The products is restricted in lab,forbidden for private consume directly.
  •  

Contact Details
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

Contact Person: admin

Send your inquiry directly to us (0 / 3000)