A premium membership for higher-level suppliers.

The products we provided are for lab research or production only,forbidden for private consumptions directly.

 

 

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home ProductsPeptide Hormone Research

FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping

Certification
Good quality Peptide APIs for sales
Good quality Peptide APIs for sales
Good Price .Product is by far the besT, very pleased and happy, wil buy again.

—— K******s United Kingdom

High Purity, fast shipping ,recomended this company.

—— Perry*****t United State

Great service I was kept informed about my order the whole time Thanks Jones.

—— E****y Australia

I'm Online Chat Now

FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping

China FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping supplier

Large Image :  FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping

Product Details:

Place of Origin: CHINA
Brand Name: MOBELBIO
Certification: GMP,ISO

Payment & Shipping Terms:

Minimum Order Quantity: 10mg
Price: According to order amounts
Packaging Details: 10mg /Vials
Delivery Time: Within 1- 3 days
Supply Ability: 1 Grams /Day
Contact Now
Detailed Product Description

 

2018 hot sale FOX 04DRI / Senolytics

 

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

 

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping

Contact Details
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

Contact Person: admin

Send your inquiry directly to us (0 / 3000)