A premium membership for higher-level suppliers.

The products we provided are for lab research or production only,forbidden for private consumptions directly.

 

 

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home Products

Peptide Hormone Research

Certification
Good quality Peptide APIs for sales
Good quality Peptide APIs for sales
Good Price .Product is by far the besT, very pleased and happy, wil buy again.

—— K******s United Kingdom

High Purity, fast shipping ,recomended this company.

—— Perry*****t United State

Great service I was kept informed about my order the whole time Thanks Jones.

—— E****y Australia

I'm Online Chat Now

Peptide Hormone Research

(39)
China Powerd Synthesis Peptide Hormone Research GLYX 13 CAS Number 117928-94-6 factory

Powerd Synthesis Peptide Hormone Research GLYX 13 CAS Number 117928-94-6

Product Name GLYX-13 CAS No. 863288-34-0 Synonym L-Threonyl-L-prolyl-L-prolyl-L-threoninamide trifluoroacetate; Thr-Pro-Pro-Thr-NH2 trifluoroacetate, Rapastinel, TPPT-amide trifluoroacetate Purity ≥98% ... Read More
2019-01-22 13:54:18
China Neuroprotective N - Acetyl Semax Peptide Pharmaceutical Intermediates Cas 80714-61-0 factory

Neuroprotective N - Acetyl Semax Peptide Pharmaceutical Intermediates Cas 80714-61-0

Neuroprotective N - Acetyl Semax Peptide Cas 80714-61-0 99% Purity Pharmaceutical intermediate Semax Peptide / ACTH(4-10) 1.Basic information: Name:Semax Peptide Synonym: ACTH(4-10) Cas No: 4037-01-8 80714-61-0 ... Read More
2019-01-22 13:54:17
China FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping factory

FOXO4- DRI Peptide Amino Acid 98% Purity 10mg Vials Free Shipping

2018 hot sale FOX 04DRI / Senolytics FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to ... Read More
2019-01-22 13:54:15
China Human Antibody Blocking Foxo4  Peptide  Vials With High Purity Free Shipping factory

Human Antibody Blocking Foxo4 Peptide Vials With High Purity Free Shipping

Source Human, recombinant Immunogen 15 amino acids near the amino terminus of human FOXO4 Formulation Peptide is supplied as 200 µg/ml solution in PBS pH 7.2 (10 mM NaH₂PO₄, 10 mM Na₂HPO₄, 130 mM NaCl) ... Read More
2019-01-22 13:54:16
China HGH 191AA Cas 12629-01-5 Human Growth Hormone Supplements For Bodybuilding factory

HGH 191AA Cas 12629-01-5 Human Growth Hormone Supplements For Bodybuilding

HGH 191AA Cas 12629-01-5 Human Growth Hormone Supplements For Bodybuilding Product Name: human growth hormone HGH EINECS No.: 235-735-8 CAS : 12629-01-5 Feature: high bioactivity, high stability, high purity, ... Read More
2019-03-01 14:20:59
China FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity factory

FOXO4 D - Retro - Inverso DRI Research Peptide FOXO4 DRI 98% Purity

Product Name :FOXO4 D-Retro-Inverso(DRI) peptide Sequence H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH Three letter code H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D... Read More
2019-01-22 13:54:15
China Blue Tops HGH 191AA  Injection Human Growth Hormone 10iu Vials For Bodybuilding Supplements factory

Blue Tops HGH 191AA Injection Human Growth Hormone 10iu Vials For Bodybuilding Supplements

Description: EINECS No.: 235-735-8 CAS : 12629-01-5 Feature: high bioactivity, high stability, high purity, 191 aa hgh Molecular formula: C990H1528N262O300S7 Formula weight: 22125D Category: White Lyophilized ... Read More
2019-01-22 13:54:14
China Melanotan II Acetate MT -2 CAS 121062-08-6 10mg Vials For Skin Tanning factory

Melanotan II Acetate MT -2 CAS 121062-08-6 10mg Vials For Skin Tanning

Product Name: Melanotan2 Other Name: Melanotan 2, MT-II Synonyms: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2 CAS #: 121062-08-6 Purity: 99% min. Molecular Formula: C50H69N15O9 Molecular Weight: 1024.18 We are ... Read More
2019-02-19 10:30:06
China Somatropin GH 191AA 10iu Vials Blue Tops BP USP Standard Free Sample factory

Somatropin GH 191AA 10iu Vials Blue Tops BP USP Standard Free Sample

Name: r-hg Appearance: White Freeze dried Powder Specification: 10 iu/vial 10vial/kit 100iu/kit Stock: In stock Supply Ability: Bulk Delivery:FedeEx, EMS, HKEMS, TNT, DHL, UPS Delivery time:within 24 hours ... Read More
2019-03-01 14:21:05
China Skin Self Tanning Peptide Myristoyl Tetrapeptide-20 Dermapep T430  Purity 98% Factory Price factory

Skin Self Tanning Peptide Myristoyl Tetrapeptide-20 Dermapep T430 Purity 98% Factory Price

Myristoyl Tetrapeptide-20 1.Basic information: INCI name: Myristoyl Tetrapeptide-20 Reference: Dermapep T430 Purity: >98% Source: synthetic Formulation: available for your reference, please contact us. MSDS and ... Read More
2019-01-22 13:54:13
Page 1 of 4|< 1 2 3 4 >|