• Chris karps,Sweden
    Always pleasure to work with you Wendy! Good communication, service minded and top notch products .
  • Andy Marchant,United Kingdom
    very happy and tell you every step of the way posted when arrived and when due for delivery the quality is excellent
  • shane bassette,United States
    This company is one worth buying from I have purchased several times from them and will continue buying in the future , Excellent customer service Very helpful with my order I would give them 10 stars if I could Thanks again
Contact Person : Wendy WS: +86-13798562250
Phone Number : Telegram: +86-13798562250
WhatsApp : +8613798562250

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7

Place of Origin China
Brand Name MALL
Certification TESTING
Model Number 86168-78-7
Minimum Order Quantity 1 box
Price US $42.5-$50
Packaging Details 2mg per vial 10 vails/box, white box packaging and any method of packing applicable to the product.For safe delivery.
Delivery Time 1-3 working days to ship, about 3-12 working days for delivery
Payment Terms , , T/T, Bank transfer and BTC or Another Reliable Payment Method
Supply Ability 5000 boxes per month
Product Details
Product Name Sermorelin Specification 2mg/vial;10vials/box
Color White Fine Powder Grade Standard Medical Grade
CAS 86168-78-7 Shelf Life 2 Years
Assay HPLC 99% Storage Cold Storage
Leave a Message
Product Description

Sermorelin Acetate Muscle Building Peptides Sermorelin CAS 86168-78-7 GRF 1-29 High Purity

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 0

 

Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Usage xanthine oxidase inhibitor

 

Sermorelin Profiles


Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first developed in the 70s, which is thought to be the shortest fully functional fragment of GHRH and has been used as a test for Growth Hormone secretion. It is often used extensively in Anti-aging Therapy along with Testosterone in men. Sermorelin Acetate affects a more primary source of failure in the GH neuroendocrine axis, has more physiological activity, and its use for adult hormone deficiency is not restricted. Compared to human Growth Hormone (hGH), Sermorelin Acetate is a growth hormone secretagogue, which means that it stimulates the pituitary gland to produce and secrete growth hormone. Also, Sermorelin Acetate and Modified GRF 1-29 contains 29 amino acids whereas hGH is a larger molecule containing 191 amino acids.

 

The Sermorelin Acetate Peptide and HGH


Sermorelin Acetate, which shares similar structure to CJC-1295, is a bio-identical synthetic hormone that is extremely effective in increasing the amount of HGH. Human Growth Hormone is a hormone released by the body that controls the reproduction and growth of the cells and each of the organs in the body. At a young age, the body's HGH production is most active while the growth rate is at its highest point. After the age of 30, for every decade of life, there is a 14% reduction in HGH production . By the age of 40, HGH production is about 40 percent of what it was at the age of 20. With the further development of Growth Hormone Releasing Factors (GHRF), such as Modified GRF 1-29, HGH production may possibly begin again by stimulating the pituitary gland.

 
Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 1

 

 


 

 

Telegram/Whatsapp/Skype:008613798562250

 


 

HOT Products
Product Spe. Product Spe.
HGH 2iu CJC1295 With DAC 2mg
HGH 10iu CJC1295 With DAC 5mg
HGH 15iu CJC1295 without DAC 2mg
HGH PEN 10iu CJC1295 without DAC 5mg
20iu Mod grf1-29 10mg
36iu PT141 (Bremelanotide) 10mg
HCG 5000iu Ipamorelin 2mg
HMG 75unit Ipamorelin 5mg
HGH Raw Powder >99% MGF 2mg
HCG Raw Powder >99% PEG MGF 2mg
HGH Fragment 176-191 2mg Sermorelin 2mg
HGH Fragment 176-191 5mg MT1 10mg
HGH Fragment 176-191 10mg MT2 10mg
TB500 2mg Gonadorelin 2mg
TB500 5mg DSIP 2mg
TB500 10mg Triptoreli/Gnrh Triptoreli 2mg
GHRP-2 10mg selank 5mg
GHRP-2 5mg oxytocin 2mg
GHRP-2 2mg Tesamorelin 2mg
GHRP-6 10mg Aod9604 2mg
GHRP-6 5mg Epithalon 10mg
GHRP-6 2mg BPC157 10mg
IGF LR3-1 0.1mg BPC157 5mg
IGF LR3-1 0.5mg BPC157 2mg
IGF LR3-1 1mg Adipotode 2mg
Follistatin 344 1mg Aicar 50mg
GDF-8 1mg Semax 5mg
ACE-031 1mg Thymalin 63958-90-7 5mg
GHK-Cu 100mg Thymosin Alpha-1 5mg

 

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 2

 

1. We offer RESHIP service with free cost if goods were catched by custom.

 

2. Free Sample for you, Just pay shipping cost.

 

3.Full experience of large numbers containers loading in Chinese sea port.


4. We provide more customized services:Products, Labels, Boxes.....


5. payment term:,, Bank Transfer and BTC or Another Payment Method.

 

Telegram/Whatsapp/Skype:008613798562250

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 3

About US

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 4

 

Telegram/Whatsapp/Skype:008613798562250

 

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 5

Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 6Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 7Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 8

Contact US

Telegram/Whatsapp/Skype:008613798562250

 

Email:manager@szmallbio.com
 
Please feel free to CONTACT ME,
I will give you the best price and get a discount for first time!!
CALL ME any time!!!