-
Peptide Steroid Hormones
-
Peptide Growth Hormone
-
Bodybuilding Human Growth Hormone
-
Testosterone Anabolic Steroid
-
SARMS Raw Powder
-
Trenbolone Steroid Powder
-
Primobolan Masteron Raw Steroids
-
Liquid Anabolic Steroid
-
Pharmaceutical Raw Materials
-
Male Enhancement Steroids
-
Weight Loss Steroids
-
CBD Isolate Powder
-
Pharmaceutical Adjuvants
-
Chris karps,SwedenAlways pleasure to work with you Wendy! Good communication, service minded and top notch products .
-
Andy Marchant,United Kingdomvery happy and tell you every step of the way posted when arrived and when due for delivery the quality is excellent
-
shane bassette,United StatesThis company is one worth buying from I have purchased several times from them and will continue buying in the future , Excellent customer service Very helpful with my order I would give them 10 stars if I could Thanks again
Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7
Place of Origin | China |
---|---|
Brand Name | ML |
Certification | TESTING |
Model Number | 86168-78-7 |
Minimum Order Quantity | 1 box |
Price | US $42.5-$50 |
Packaging Details | 2mg per vial 10 vails/box, white box packaging and any method of packing applicable to the product.For safe delivery. |
Delivery Time | 1-3 working days to ship, about 3-12 working days for delivery |
Payment Terms | , , T/T, Bank transfer and BTC or Another Reliable Payment Method |
Supply Ability | 5000 boxes per month |
Product Name | Sermorelin | Specification | 2mg/vial;10vials/box |
---|---|---|---|
Color | White Fine Powder | Grade Standard | Medical Grade |
CAS | 86168-78-7 | Shelf Life | 2 Years |
Assay | HPLC 99% | Storage | Cold Storage |
Sermorelin Acetate Muscle Building Peptides Sermorelin CAS 86168-78-7 GRF 1-29 High Purity
Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Usage xanthine oxidase inhibitor
Sermorelin Profiles
Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first developed in the 70s, which is thought to be the shortest fully functional fragment of GHRH and has been used as a test for Growth Hormone secretion. It is often used extensively in Anti-aging Therapy along with Testosterone in men. Sermorelin Acetate affects a more primary source of failure in the GH neuroendocrine axis, has more physiological activity, and its use for adult hormone deficiency is not restricted. Compared to human Growth Hormone (hGH), Sermorelin Acetate is a growth hormone secretagogue, which means that it stimulates the pituitary gland to produce and secrete growth hormone. Also, Sermorelin Acetate and Modified GRF 1-29 contains 29 amino acids whereas hGH is a larger molecule containing 191 amino acids.
The Sermorelin Acetate Peptide and HGH
Sermorelin Acetate, which shares similar structure to CJC-1295, is a bio-identical synthetic hormone that is extremely effective in increasing the amount of HGH. Human Growth Hormone is a hormone released by the body that controls the reproduction and growth of the cells and each of the organs in the body. At a young age, the body's HGH production is most active while the growth rate is at its highest point. After the age of 30, for every decade of life, there is a 14% reduction in HGH production . By the age of 40, HGH production is about 40 percent of what it was at the age of 20. With the further development of Growth Hormone Releasing Factors (GHRF), such as Modified GRF 1-29, HGH production may possibly begin again by stimulating the pituitary gland.
Telegram/Whatsapp/Skype:
HOT Products | |||
Product | Spe. | Product | Spe. |
HGH | 2iu | CJC1295 With DAC | 2mg |
HGH | 10iu | CJC1295 With DAC | 5mg |
HGH | 15iu | CJC1295 without DAC | 2mg |
HGH PEN | 10iu | CJC1295 without DAC | 5mg |
20iu | Mod grf1-29 | 10mg | |
36iu | PT141 (Bremelanotide) | 10mg | |
HCG | 5000iu | Ipamorelin | 2mg |
HMG | 75unit | Ipamorelin | 5mg |
HGH Raw Powder | >99% | MGF | 2mg |
HCG Raw Powder | >99% | PEG MGF | 2mg |
HGH Fragment 176-191 | 2mg | Sermorelin | 2mg |
HGH Fragment 176-191 | 5mg | MT1 | 10mg |
HGH Fragment 176-191 | 10mg | MT2 | 10mg |
TB500 | 2mg | Gonadorelin | 2mg |
TB500 | 5mg | DSIP | 2mg |
TB500 | 10mg | Triptoreli/Gnrh Triptoreli | 2mg |
GHRP-2 | 10mg | selank | 5mg |
GHRP-2 | 5mg | oxytocin | 2mg |
GHRP-2 | 2mg | Tesamorelin | 2mg |
GHRP-6 | 10mg | Aod9604 | 2mg |
GHRP-6 | 5mg | Epithalon | 10mg |
GHRP-6 | 2mg | BPC157 | 10mg |
IGF LR3-1 | 0.1mg | BPC157 | 5mg |
IGF LR3-1 | 0.5mg | BPC157 | 2mg |
IGF LR3-1 | 1mg | Adipotode | 2mg |
Follistatin 344 | 1mg | Aicar | 50mg |
GDF-8 | 1mg | Semax | 5mg |
ACE-031 | 1mg | Thymalin 63958-90-7 | 5mg |
GHK-Cu | 100mg | Thymosin Alpha-1 | 5mg |
1. We offer RESHIP service with free cost if goods were catched by custom.
2. Free Sample for you, Just pay shipping cost.
3.Full experience of large numbers containers loading in Chinese sea port.
4. We provide more customized services:Products, Labels, Boxes.....
5. payment term:,, Bank Transfer and BTC or Another Payment Method.
Contact US