Medical Grade Diagnostic Agent Sermorelin 2mg Peptides Hormones Cas 86168-78-7

Diagnostic Agent Sermorelin 2mg Peptides Hormones Cas 86168-78-7

Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Usage xanthine oxidase inhibitor

Sermorelin Profiles

Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first developed in the 70s, which is thought to be the shortest fully functional fragment of GHRH and has been used as a test for Growth Hormone secretion. It is often used extensively in Anti-aging Therapy along with Testosterone in men. Sermorelin Acetate affects a more primary source of failure in the GH neuroendocrine axis, has more physiological activity, and its use for adult hormone deficiency is not restricted. Compared to human Growth Hormone (hGH), Sermorelin Acetate is a growth hormone secretagogue, which means that it stimulates the pituitary gland to produce and secrete growth hormone. Also, Sermorelin Acetate and Modified GRF 1-29 contains 29 amino acids whereas hGH is a larger molecule containing 191 amino acids.

The Sermorelin Acetate Peptide and HGH

Sermorelin Acetate, which shares similar structure to CJC-1295, is a bio-identical synthetic hormone that is extremely effective in increasing the amount of HGH. Human Growth Hormone is a hormone released by the body that controls the reproduction and growth of the cells and each of the organs in the body. At a young age, the body's HGH production is most active while the growth rate is at its highest point. After the age of 30, for every decade of life, there is a 14% reduction in HGH production . By the age of 40, HGH production is about 40 percent of what it was at the age of 20. With the further development of Growth Hormone Releasing Factors (GHRF), such as Modified GRF 1-29, HGH production may possibly begin again by stimulating the pituitary gland.

Telegram/Whatsapp/Skype:008613798562250

1. We offer RESHIP service with free cost if goods were catched by custom.

2. Free Sample for you, Just pay shipping cost.

3.Full experience of large numbers containers loading in Chinese sea port.

4. We provide more customized services:Products, Labels, Boxes.....

5. payment term:,, Bank Transfer and BTC or Another Payment Method.

Telegram/Whatsapp/Skype:008613798562250

About US

Telegram/Whatsapp/Skype:008613798562250

Contact US